PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen11g012490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 1253aa    MW: 143267 Da    PI: 8.4305
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen11g012490.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.84e-3010391089151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF    1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51  
                        krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fs++g+lyeys+
  Sopen11g012490.1 1039 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSN 1089
                        79***********************************************95 PP

2K-box96.25.1e-32110912036100
             K-box    6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96  
                           ++e +a+ +qqe++kL+++i+++q+++Rhl+Ge+L+sL+++eL+qLe++Le+++++iRskK+e +l+++e+l k+e +l++en  Lr+
  Sopen11g012490.1 1109 AYTTQELNAQFYQQESKKLRQQIQMIQNTNRHLVGEGLTSLNVRELKQLENRLERGITRIRSKKHEAILAETEDLHKREIQLEQENAFLRS 1199
                        33478999*********************************************************************************** PP

             K-box   97 klee 100 
                        k++e
  Sopen11g012490.1 1200 KIAE 1203
                        *986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd003031.63E-15313407No hitNo description
SuperFamilySSF566722.52E-33603729No hitNo description
CDDcd092741.16E-43628729No hitNo description
Gene3DG3DSA:3.30.420.105.9E-6849889IPR012337Ribonuclease H-like domain
SMARTSM004323.6E-4110311090IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.85210311091IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.24E-3210321108IPR002100Transcription factor, MADS-box
CDDcd002659.90E-4210321108No hitNo description
PRINTSPR004041.2E-3010331053IPR002100Transcription factor, MADS-box
PROSITE patternPS00350010331087IPR002100Transcription factor, MADS-box
PfamPF003193.8E-2510401087IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-3010531068IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-3010681089IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2411131201IPR002487Transcription factor, K-box
PROSITE profilePS5129715.40411171207IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1253 aa     Download sequence    Send to blast
MPNTRSRGIP VIEPDPELDR TLRRMNQNLG IQGDEVDRQM PPLVDARDLV LPDICGEGLP  60
SEDPHAHIAK LRDAFLARYY PVSKKLYHKD RVNNFVALPR ESVSSSWDRF TSFLRSVPNH  120
RIDDESLKEY FYWGQDDNNK AVLDIIAGGS YGECPYAEIA EKLEKISRNN KAWSTRKSDT  180
WRNTFAVQSA HNSVVDDLCE EMAQMRTELG LVLKHVVGGA EKENWHQGQG NQGRNYGNYN  240
LEGHYVRYGN YNRNNNFNQE ALEQMPRYAK FKKDLVTKKR SVTFKDHDRM QHCSAMATRS  300
LVQKKENPGA FHIPCTIGLL HFAKALCDLG ASINIMPLSI YKKLGLGNPN PTTMQLLMAD  360
RTVKRPIGIL HDVLVKVESF IFPADFVILD CEANFEVTII LGRPFLATGR ALVAMEKGVE  420
ESSEVRIEER LGVEALATVI MNFDGDGIDE YESLVAALDR GNVRFKPKKF ELDMQYRESP  480
PAKPSIEEAP KLELKPLPPH LKYVFLGKDD TLSVNITSDL NVHQVESLVK VLKRFKRAIM  540
WTIVDIIGIP PGIYSHKIQL MPDHKPSIEH QRRQNPPMKE VAKKEIIKWL DARVIYPIAD  600
SSSAFGELKE KLVSAPIIIS TDWSKSFEVM CDASGITLGV VLGQRRDKIL HPIYYASKAL  660
NEAQKNYTVT EQELIAVVFP FEKFRSYLLG TKVIVHTDHS ALRYLMAKKY AKPRLIRWVL  720
LLQEFDFEIL RIIWLVISSH RTCPFIKEEK FMYDVKKFFW DEPYLYRSCA NGIIRRCVPE  780
VEMLSVLEAC HSLPVGGHHN GILTADKILQ CGYYWSTIHQ DAHEFAKACD RCQRDGGISR  840
KQELPLNPML VIELFDVWGI DFMGPFVSSQ GMKYILVAFD YVSKWKIGLQ NSLTDPSTDR  900
HAYDGPSQAS VVSSSRVVEA EKSTTDGAVI VERGTTEGDV DAEGTTEGVQ TTEEEICPKE  960
NAEDLSRNCR SDHLRSLQRS VVTVTVRRWH RSEKKIAAKG SWGTTSLLEK TRRKIAYLIH  1020
STHSDRSIRL MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEIALIVFST  1080
RGRLYEYSNN NVKATIERYK KATAETSSAY TTQELNAQFY QQESKKLRQQ IQMIQNTNRH  1140
LVGEGLTSLN VRELKQLENR LERGITRIRS KKHEAILAET EDLHKREIQL EQENAFLRSK  1200
IAENERLQEL SMMPSGGEEY NAFQQYLARN MLQLNMMETA LPSYDPLSPD HKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-1910311099169Myocyte-specific enhancer factor 2B
1tqe_Q3e-1910311099169Myocyte-specific enhancer factor 2B
1tqe_R3e-1910311099169Myocyte-specific enhancer factor 2B
1tqe_S3e-1910311099169Myocyte-specific enhancer factor 2B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0987360.0AY098736.2 Lycopersicon esculentum TAGL11 transcription factor mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.11e-89MIKC_MADS family protein